SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 51453.JGI103348 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  51453.JGI103348
Domain Number 1 Region: 92-184
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.14e-23
Family Cold shock DNA-binding domain-like 0.0000986
Further Details:      
 
Domain Number 2 Region: 186-308
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.66e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0076
Further Details:      
 
Domain Number 3 Region: 42-92
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000000366
Family ECR1 N-terminal domain-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 51453.JGI103348
Sequence length 332
Comment (Trichoderma reesei)
Sequence
MPITILNPQPSTPAPRRPRAMDIDMDVASDSDSDSEMGGAAILTPGTVITSNPQWMRGHG
TYVPPNTTNITSSLAGTLTRTNKLLSVRPLRARYNPEIGDLVVGRIVEVQAKRWRVDVAA
AQLAILQISAINLPGGILRKRTETDELQIRSFFAEGDLLVAEVQQLHQDGAASLHTRSLK
YGKLRNGVFVAVGGTGGGAGVVRSKRQLWTMETANGGGKIDVLLGVNGYIWISKHVESDV
AAEAAGINRMEESVSSQIYSSQNNHIDVPTMREIARCRSVILALVENGVKVDEDTVTRGY
LEAVEFGRESADDDIYLGGERGKRLAAALSGR
Download sequence
Identical sequences A0A024S4D5 G0R7T4
XP_006961477.1.9351 51453.JGI103348 jgi|Trire2|103348|fgenesh5_pg.C_scaffold_1000981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]