SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 51453.JGI107239 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  51453.JGI107239
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.3e-38
Family Calponin-homology domain, CH-domain 0.0000262
Further Details:      
 
Domain Number 2 Region: 165-231
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 8.5e-17
Family EB1 dimerisation domain-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 51453.JGI107239
Sequence length 245
Comment (Trichoderma reesei)
Sequence
MGESRQELLNWLNSLLQLNMTKVEQCGTGAALCQVFDSIFLDVPMSKVKFNVSGDYAYIQ
NFKILQNTFLKHQVDKPIPVEQLVKCKMQDNLEFLQWTKKFWDLNFPDHDYDAVARRKGA
GVAPANTGAPRATVSSAGARRAGGGTTPSTGPRVAKAAPGPGTAALQAEIGTLKETVSGL
ERERDFYFSKLRDIELLIQQAVEEDPELEKQEDGLVKHIQTILYSTEEGFEIPAEAEGLD
DQETF
Download sequence
Identical sequences A0A024S7S3 G0RJ31
jgi|Trire2|107239|fgenesh5_pg.C_scaffold_9000042 XP_006965435.1.9351 51453.JGI107239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]