SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 51453.JGI4751 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  51453.JGI4751
Domain Number 1 Region: 197-397
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.29e-45
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 
Domain Number 2 Region: 872-978
Classification Level Classification E-value
Superfamily CAD & PB1 domains 3.36e-17
Family PB1 domain 0.0063
Further Details:      
 
Domain Number 3 Region: 395-522
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000068
Family Pleckstrin-homology domain (PH domain) 0.039
Further Details:      
 
Weak hits

Sequence:  51453.JGI4751
Domain Number - Region: 81-164
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0284
Family Calponin-homology domain, CH-domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 51453.JGI4751
Sequence length 982
Comment (Trichoderma reesei)
Sequence
MSSSAPRTSQLSGSTYAGSSTSLTTLNSDMTVVANGPVVATSNIINQKADASRSLYQICI
SLKQRLAQVPGFEPFLENLDPTDPVDPLWNLFRSGYPLLVIYNSLQPAEPLSVDDANASD
SKKSKIAIFKFVQACMKELQVPPSDSFVITDLMGNDTSGFVKVTQVVNYVLDLAEQRGHL
LQLQPYPDGEPAEAGDGPKMTYRDHVVKELVDTERKYVQDLENLHDLKKALEQKGVIPGD
VVHQIFLNINSILDFQRRFLIRVETTNSMPAAIQRWGQPFVTHEEFFSIYQPFIANQRKA
AQVAKEVFDQIQLSDHPVAADFNTLDGFLLKPMQRLVKYPLLLKDLAKKTEDAETKEDLL
AGCEAAERVLQKANEAVNRDLLDDALEELIVRVDDWKSHKIESFGKLLLHGIYGVITGKS
EQEKDYEIYLFECILLCCKEISPNKSKDKKDKARQQGPKTKNKNAKLQLKGRIFMTNVTD
VVSLSKPGSHSVQIWWKGDPGVENFTIKFLTEEMMKKWATGLETQRKENAPKLAASPADD
PTDFAWTRDNAGGLENPYLQQEDDDDDDIGPATAPAQFPMPASSFGGAIPRTASSSNLRE
LRQRSVTAETSATLASIARAPPPRFPMPMPPPPPVAPLSLQTASTMSIPSPGFRGGDSYF
SPIGDSPASSRTSTTSGMFPPTSYPFPKSGTPQPGWDENNRYTAPAMPRAPSRDGTPPNV
YPNGRNPRGPLKDSNAAAAAAAAAAANGSQRSRSYSTPDVNAQGQRRQPSQSNIPAVPGI
PLHLHPAHDSSIPRSQTGSPRNDAPAPGRTNTQSPGAPGVRMHKHSHSGSMSGSTGGTMA
QFPTQPIYPRQNTPGPAIGANGTAGSRTNPTQITSPDVAMPTQLKVRVTCDTGNYITLVV
AFNITYQSLVDRIDAKLARFTSSSIAQGALKLRYQDEDEDFVTIESDDDIQIAFMEFRDG
MKNAFNGGVGEIELFCVGEMAP
Download sequence
Identical sequences A0A024S5N2 G0RP79
XP_006966926.1.9351 51453.JGI4751 jgi|Trire2|4751|fgenesh1_pm.C_scaffold_15000030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]