SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 51453.JGI73933 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  51453.JGI73933
Domain Number 1 Region: 228-341
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.53e-23
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Weak hits

Sequence:  51453.JGI73933
Domain Number - Region: 151-212
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00019
Family Eukaryotic type KH-domain (KH-domain type I) 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 51453.JGI73933
Sequence length 824
Comment (Trichoderma reesei)
Sequence
MEDSERRPKRSRFDQTEPEPKRASRFDRRSRSPPARRSEGRERSPLPTKEESPETKKAPV
DAAAAAAAAAAKINAQLQARKAPQHVDVPPIKSSSGTPADGGDQEMKKEMYVADGDFIQD
IEVNDLRNRYLLTKGSTQEMSSNVDSNSADVTTRGSYYPNKSMATAANPPLYLHITSTTK
AGLEAAVEKINELIKQELPQLVDERRFRRRDQEPQPPVERDEYGRRKWPEEKIPIDLEPV
HGFNLRAQVVGHGGAYVKHIQQETGCRVQIKGRGSGYLEAATNHESDENMFLHVTGPDPN
MVAKAKELCEDLIANVKEQYEEFKARPPRYNNDRGGYGDRGGYGDHHHRGSHDRHGGSHH
NSYSSYNRYNSEPRASNSPAPVAAPAANAADYAAQYAQYYNGADPYAAWGGYANYVALYQ
QYYGGQTQAPAQSSHAAAAPGQAAPPPPPPPAEAAPPPPPPPSSAPPPPPPPSGPPPPGG
SFSAVTRTRVGGSGHSECQKEMSHQSYPHHDPIKEPHSVSVKVLRLSQPSLVTQHPIDPP
FSPPNTKSQPAPASLAYAPSSTNPDPFLLSPILNLPVSFGSAYVGETFSCTLCANNDLPP
DAAKRIRDVRIEAEMKTPGLGGTQKLELGPANTHEGAAAGGGGVDLEPGGTLQRIVGFDL
KEEGNHVLAVTVSYYEATETSGRTRTFRKLYQFICKASLIVRTKVSGLDANTSSSGTRKW
ILEAQLENCSEDVMQLEKVVLDVEDGLGYHDCNWASDGDQKPVLHPGEIEQVCFLVHEKG
ADSGVRMTPDGRIIFGVLGIGWRGEMGCRGYLSTGKLGARIAVR
Download sequence
Identical sequences G0R860
XP_006961669.1.9351 jgi|Trire2|73933|estExt_GeneWisePlus.C_10787 51453.JGI73933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]