SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 51453.JGI76828 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  51453.JGI76828
Domain Number 1 Region: 65-146
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000164
Family Cold shock DNA-binding domain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 142-230
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000228
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Weak hits

Sequence:  51453.JGI76828
Domain Number - Region: 7-54
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.0596
Family ECR1 N-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 51453.JGI76828
Sequence length 232
Comment (Trichoderma reesei)
Sequence
MSSEPIFVLPGDRIDASLIPSHEKKPLRLGPGLRHVPPSDLVPTLAGQLVTDRQKNAIRV
ETANGRYIPRVGELVIGTVNKSAQEVYFVSLSDYTAPALLPQLSFESATKKTRPILLPGA
LVYARCVSASTGKADGLGPLVGGMLFTISLGMSRLLMMPKKAQQGRLVVLDELADAGVQF
ETATGRNGRLWVDSDSTKAIIAVGRAIQETDEKSLGVDEQRRLVKKLIKELS
Download sequence
Identical sequences G0RG72
XP_006964167.1.9351 51453.JGI76828 jgi|Trire2|76828|estExt_GeneWisePlus.C_60405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]