SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 51511.ENSCSAVP00000000079 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  51511.ENSCSAVP00000000079
Domain Number 1 Region: 17-248
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.43e-82
Family Calponin-homology domain, CH-domain 0.0000212
Further Details:      
 
Domain Number 2 Region: 296-418
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-33
Family Spectrin repeat 0.00000218
Further Details:      
 
Domain Number 3 Region: 532-652
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-23
Family Spectrin repeat 0.0000178
Further Details:      
 
Domain Number 4 Region: 419-528
Classification Level Classification E-value
Superfamily Spectrin repeat 7.72e-23
Family Spectrin repeat 0.00000644
Further Details:      
 
Domain Number 5 Region: 762-895
Classification Level Classification E-value
Superfamily EF-hand 2.62e-21
Family Calmodulin-like 0.044
Further Details:      
 
Domain Number 6 Region: 658-769
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000236
Family Spectrin repeat 0.0000773
Further Details:      
 
Weak hits

Sequence:  51511.ENSCSAVP00000000079
Domain Number - Region: 258-278
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00588
Family Calponin-homology domain, CH-domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 51511.ENSCSAVP00000000079
Sequence length 923
Comment (Ciona savignyi)
Sequence
QGGCEINMEDYMTQEDGWEREGLLDPAWERQQRKTFTAWCNSHLRKAGTQIEEIDEDFRN
GLKLMLLLEVISGEHLPRPDRGKMRLHKIANVNKALNFIASKGVRLVSIGAEEIVDGNTK
MTLGMIWTIILRFAIQDISVEESSAKEGLLLWCQRKTAPYKNVNVQNFHMSWKDGLAFCA
LIHRHRPDLIDYNKLRKDDPLTNLQTAFEVAEKHLDIPQMLDAQELQDMAKPDERAVMTY
VSCFYHAFSGAQKVNYNYMVKPDERSIMTYVAAFYHAFSGNDKAETAANRILKVLGVNQE
NERLMDEYERLASDLLEWIARMKPWLDDRTTDNTMEGVQRKLDDFRDYRAKQKPPKIDEK
GHLEAAYNTLQTKLRLSNRPAFMPSEGKLVSDITSAWKGLEGAEKGYEEWLLAEMRRLER
LDHLAKKFYYKAGIHEKWTVGQEENLASEEYKRASLQELKALMKKHEAFESDLAAHQDRV
EQIAAIAQELNDLDYHDTETINDRCRDICDEWDRLGSATQKRRTALENMEQILESIEQQH
LEFAKRAAPFNNWMDCAKEDLEDMFIVHSMLEIRKLISAHGVFKDTLPDAQKEKESIIAL
VQNIKKIQRQYDLPDESCENAYTTVTPEEIESKWNVVRNMVPARDASLQAELGKQQNHEL
LRTEFAQIANQFGPWMVEFTKEINRIAMSMVGSLEDVKNSLMDYQQRMMANKPQLDTLEK
KHQQMQEALVFDNPHSAYSMESLHASWEHIKALLSLTINEVENQILMRDAKGLTQEQMNE
FRASFNHFDRDNSGLLSADEFNGCLTSLGYDVDKSKEKGEAEFQRIMALVDPSGTNTVTF
QSFIEFMTRESTDSDTAEQVVESFRILAGDKPYITADELRRELPPDQADYCISRMSRYSS
SDAPPDALDYASFSTALYGESDL
Download sequence
Identical sequences H2Y431
51511.ENSCSAVP00000000079 ENSCSAVP00000000079 ENSCSAVP00000000079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]