SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 51511.ENSCSAVP00000005505 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  51511.ENSCSAVP00000005505
Domain Number 1 Region: 3-63
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000115
Family Eukaryotic type KH-domain (KH-domain type I) 0.00034
Further Details:      
 
Domain Number 2 Region: 280-354
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000019
Family Eukaryotic type KH-domain (KH-domain type I) 0.00011
Further Details:      
 
Domain Number 3 Region: 88-174
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000167
Family Eukaryotic type KH-domain (KH-domain type I) 0.00032
Further Details:      
 
Domain Number 4 Region: 159-217
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 0.0000000019
Family Prokaryotic type KH domain (KH-domain type II) 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 51511.ENSCSAVP00000005505
Sequence length 541
Comment (Ciona savignyi)
Sequence
RDIMSETIRLPDDLVGLIIGRGGENIMRMQRETGCRIQITQSIPGTKERPCTLSGTPEQI
EYVHFLYGMDGGMGGGMGGGNMGGMGDGVEKSIEIAVPPDKCGLIIGKGGETIKMLQQSL
GVKMLLIQDSTDNIGQSKPLRITGAQMNLDNAVNAVHQLMANRDQQLAQQKPNMFGDDVN
KTIIPVPKAAVGVVIGKGGDMINQIQNVTGTRIQFKPGNYNISDIFSLIHHYRLSCNEYR
VILPLPGNRSGGGGGGGPPGGMGSFGQWEGPNMGRGNRGMGVSSEEHLVPANKTGLVIGK
GGDTIKQINMQSGAHAEIQRNPPPGSDLNYKTFIIKGTPEQIKMCRQLIQEKVDAGPGGQ
NNGQMQSSHMGGQPPMGNFGPPQVCCGYGGLPPAASYGHPNPLQGPPQAPQAPQSYQQPW
GSQFQQWSSPSVSAPQQNGADPNSSNAAAWQSYLQMYGAQAQAAYQQPTAAAAVSAAPAS
QPDYSKQWDEYLKQNGELIFCPTRHHPGNADYSAAWAEYYRQYYAMHGQAGYAAAAAAAG
Q
Download sequence
Identical sequences H2YJK6
51511.ENSCSAVP00000005505 ENSCSAVP00000005505 ENSCSAVP00000005505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]