SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 51511.ENSCSAVP00000006175 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  51511.ENSCSAVP00000006175
Domain Number 1 Region: 169-270
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.33e-28
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000331
Further Details:      
 
Domain Number 2 Region: 75-167
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.53e-27
Family Cold shock DNA-binding domain-like 0.0000166
Further Details:      
 
Domain Number 3 Region: 23-75
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.000000000314
Family ECR1 N-terminal domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 51511.ENSCSAVP00000006175
Sequence length 274
Comment (Ciona savignyi)
Sequence
SITISLPSSRKCCSNSNLTNSYLVTPGDVITEDTDYMRGHGTYSIEGGEGDKLHSSVAGV
VERINKLICVRALKTRFTGEVGDIVVGRVKEVQQKRWKVETNSRLDSILQLSSVNLPGGE
LRRRSATDELNMREYLNEGDLISAEVQQVNSDGILSLHTRSLRYGKLSQGCCVVVSPSLI
KRRKNHIHNLPCGASIILANNGFVWIHPSRSECDKDADGGFLISNEAINYDEREIICRLR
NCVKCLAHRNVILFDTSVLYAYEASLPYKVSVVM
Download sequence
Identical sequences H2YLH3
ENSCSAVP00000006175 51511.ENSCSAVP00000006175 ENSCSAVP00000006175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]