SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 51511.ENSCSAVP00000008792 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  51511.ENSCSAVP00000008792
Domain Number 1 Region: 113-236
Classification Level Classification E-value
Superfamily C-type lectin-like 1.46e-28
Family C-type lectin domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 51511.ENSCSAVP00000008792
Sequence length 236
Comment (Ciona savignyi)
Sequence
MFSLKVLVVLLAFVNAVVQASNQVVLTCESSPPEKGDQGPPGPPGHYGAKGQKGDTGSTA
ELENSISALEDRLKETEEDIAAMAKTISDLQKKGGKCQCMKVIGGKIWHGPGNGYFYYTV
QSDMTYDQAKSKCSQLGATVATQGPKSRDVMRILEAQMSVLTTEEYWIGLTDKAGEGRYV
WEDGTALQSSQANWKPGEPNNTDNNEDCIGINYLDSLQWNDYLCTHNLYALCERKA
Download sequence
Identical sequences H2YTY2
51511.ENSCSAVP00000008792 ENSCSAVP00000008792 ENSCSAVP00000008792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]