SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 51511.ENSCSAVP00000012170 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  51511.ENSCSAVP00000012170
Domain Number 1 Region: 35-98
Classification Level Classification E-value
Superfamily Integrin domains 0.00000105
Family Integrin domains 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 51511.ENSCSAVP00000012170
Sequence length 144
Comment (Ciona savignyi)
Sequence
MQAVNRYNLSTSTSLINTASKPKVTLIPNPGHLTQQTYNCSGKMEKQPAYCQEVRCSVQN
LAAGERINFLANFRLWTHSFNLKNANVSFVTGFSFTSKQSTLIINKDGIPHQDIHNETII
TAKLFEAEVITPQPDLSLIIGLSV
Download sequence
Identical sequences H2Z3K8
51511.ENSCSAVP00000012170 ENSCSAVP00000012170 ENSCSAVP00000012170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]