SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 51511.ENSCSAVP00000013381 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  51511.ENSCSAVP00000013381
Domain Number 1 Region: 976-1103,1135-1341
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.1e-67
Family p120GAP domain-like 0.00036
Further Details:      
 
Domain Number 2 Region: 1-149
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.57e-36
Family Calponin-homology domain, CH-domain 0.0000456
Further Details:      
 
Domain Number 3 Region: 1562-1660
Classification Level Classification E-value
Superfamily RGC domain-like 1.11e-26
Family RGC domain 0.0000173
Further Details:      
 
Domain Number 4 Region: 734-784
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000611
Family Motor proteins 0.017
Further Details:      
 
Weak hits

Sequence:  51511.ENSCSAVP00000013381
Domain Number - Region: 672-701
Classification Level Classification E-value
Superfamily WW domain 0.000147
Family WW domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 51511.ENSCSAVP00000013381
Sequence length 1660
Comment (Ciona savignyi)
Sequence
RWMEYCLHEDLPPSVELEEGLRNGVFLGKLAHFFAPDTIPLRKIYDKDMKKYEQKGLHFK
HTDNINHFFRAMEKVGLPSIFYPETTDIYDRKNMPKTVYCVHALSLYLFKLGLAPQMKDL
YGIAEFTEEELNNMQKELDKYGINMPQFSKIGGILANELSVDEAALHAAVIAINEALDAG
DAEATMKAMHNPNACLTSIEDGYVEEYQERLLASKKAKAEAAKNKVVKHRQLCQCETTEE
ERDMYEELLTHAELQGNITKINLDIKVEKVNRDLLSDGENLISDLKNLGISNIDPNNRTW
YLDQLQKDLNAKREVKSVPTLDKDEIQAAIIAANLLATKQRQQSKVKGGYIRLKRKTVRF
IGVKLVGEQDETVSNINSLLNDSGSPEDLERELKKMEGNFPAIVDGMAHLYHSELTKQRE
LKGEDLTHEEICEALRHLNALAALNRELEVGDVESVWAAMQNPDLGLERLEQGNRTRCCV
SGLQGQQKKDVQYLNLKSIQETVDLINTQVSEEHSTIKAVHDVNEALSKDDRDAILAALL
NPSLHLEHVDPSNITQYLRLLKKRKHEKSVETGDADPALWIDEIQACIDDANAQTRQALK
QASAVTAVNIALEDDEWEQTYELLKHNDIALASLTSECASTYHDQLREMREEKLEEAYIM
FNPSNECLKDTTWVAYRTKEGYTYYFNTENLNGSWDEPEGFNADTAQLNKDEIQECISMV
SSAYDRAQLWRDNEPLIIKLQSFCRMYLARKAYQERKDFIANHLPAIICIQAHWRGFAQW
KKYTDRMLYLQSHLATIIMVNKYLIWKSPSSLLQRRFAMWRERSQYQKRLKYFRDHVHII
IKLQAWFRSNKARHDYKTLSKIRLIKLLAGVENPPLTVVQKFVHLLDQRANDFAEEIELQ
ELKQNVVQCIKSNNELEEALNTMDIKIGLLVKNRITLQDVINHSKNLKKKGGKDAGESSP
AAGLKSLNKSNRARLEAYQHLFYLLQTNPTYFGKLIFKMAAGRTTNFMQSVILSVYNYAS
NHREEYLLLKLFKTALQEEIESKVDKVKEIATGNPLVIKMVVTFNRGAKGQSSLRQILAP
QVNDLLAKNSLNINMSPVEIYKSWISQKETETGEASDLPYEVTTTEAMKHDEVKKRVEDS
ISQLRTVTDAFLAAILASIEEIPYGLRYIAKCLKNLLKKKFPDTPEEEVLKMVGNLIYYR
YMNPAIVAPDGFDVIDVSAGAAGLNNDQRKNLGSIAKVLQFASTGKTFAGDMEHLRSINQ
YLMEAYVRFKKFFEAVCDVPEPEEKYNIDEYSDAVLLVKPVIFISLKEVLDTHKLLLEHE
DEVASDASDPIHEMLEELGEVPDIASLIGETGGTELTDEQKTALLNTEISLTLASKVEIK
EDDESDIKNLILRTKRMVIDIIRIQVGENLTEVLNTPATDDQNVEKLEMEKKKREDVKED
KDSMLRTRSLLNENKLPLEDMKRRVLRNLKKLQEHGIVTSDDHYQAIVNMIARDIRNQRR
YRQRRKQELTKLKQNLERLDQKSKFFEEQSDYYNQYIKSCLASLANKSKKAQKKKKRKVA
AIKYTASELHRKKVLLEIEGLETGQFRNVMFEIGQTEDDVGRFEVSAKLLGVNMEKVTLV
FQDLLQLQYEGVSVMKMFDGRAKINVNLLIFLLNKKFFGK
Download sequence
Identical sequences H2Z719
ENSCSAVP00000013381 51511.ENSCSAVP00000013381 ENSCSAVP00000013381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]