SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 51511.ENSCSAVP00000014719 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  51511.ENSCSAVP00000014719
Domain Number 1 Region: 116-218
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.72e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0048
Further Details:      
 
Weak hits

Sequence:  51511.ENSCSAVP00000014719
Domain Number - Region: 71-128
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 0.0693
Family Gametocyte protein Pfg27 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 51511.ENSCSAVP00000014719
Sequence length 349
Comment (Ciona savignyi)
Sequence
MSSETADLLTVPDGWKDPGIKPEDNKYGMLEESSFATLFPKYREKYLQECWPLVKNMLSE
YKIEAVLDLIEGSMTVKTTRKTWDPYSILNARDMIKMLSRSVPFEQAKRIFDDNTSCDII
KIGSLVRNRERFVKRRQRLVGPNGATLKALELLTGCYIFVQGNTATVLGTHAGLKDARKV
ILDTMKNIHPVYNIKSLMIKRELAKDPNLKNESWDRFLPKFKRKNVKKKAKPRKEKKAYT
PFPPPQPESKIDKEIASGEYFLKEAERKRKKTEERREKQAAVTSERKQKRARSLVAPQEL
KLPHKPETNSANSKLDISSLKKKVNKAKKLKLGKLSTNDEDVNSKVGMT
Download sequence
Identical sequences H2ZAV4
51511.ENSCSAVP00000014719 ENSCSAVP00000014719 ENSCSAVP00000014719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]