SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 51511.ENSCSAVP00000015324 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  51511.ENSCSAVP00000015324
Domain Number 1 Region: 18-154
Classification Level Classification E-value
Superfamily SNARE-like 6.41e-28
Family Clathrin coat assembly domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 51511.ENSCSAVP00000015324
Sequence length 182
Comment (Ciona savignyi)
Sequence
VKLGINMDGVLEASLYTIKAILILDNDGERLVAKYYDDTYPTLREQKLFEKNVFNKTHKS
DSEIALLEGQTVVYKGNVDLFFYVIGSSQENELMLMSVLTCLYDSVNLLLRKNVEKRILL
RHIDSVFLIVDEIVDGGVIMQVDASQVLDQIVMRGEDIPLTEQTITQVLQSAKDQIKWSL
LK
Download sequence
Identical sequences H2ZCK8
51511.ENSCSAVP00000015324 ENSCSAVP00000015324 ENSCSAVP00000015324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]