SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 51511.ENSCSAVP00000015805 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  51511.ENSCSAVP00000015805
Domain Number 1 Region: 17-159
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.58e-34
Family Calponin-homology domain, CH-domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 51511.ENSCSAVP00000015805
Sequence length 200
Comment (Ciona savignyi)
Sequence
MANRPKGYGYSREVASKIDAKYSDEDEMVIVAWISAIVESHPEDAGKQAFHAWLKDGIVL
CKLMNEIVPGSCKPNNPSNSTIEAMIRNKEMENIGMFLTAASAYGVKHLDLFQTVDLYEA
GNLAQVQTTMFKLSSTAHKNGFGGPQIGVKIADENKRHFDDQKTREGRNVIGLQMGTNQV
ASQSGMTAYGLGRQLTPQTK
Download sequence
Identical sequences H2ZDY9
ENSCSAVP00000015805 51511.ENSCSAVP00000015805 ENSCSAVP00000015805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]