SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 51511.ENSCSAVP00000017345 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  51511.ENSCSAVP00000017345
Domain Number 1 Region: 50-101
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000038
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 2 Region: 123-168
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000186
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 51511.ENSCSAVP00000017345
Sequence length 172
Comment (Ciona savignyi)
Sequence
MSETQDSESSTAEKRPHDEMEDDLESKRHRSSSHDAGYERGHHGGRGGGHGEKYEIRILI
PSHTAGAIIGKGGSNIRDLRHEFNASIQVPDSQGFERVVAAVTTTKEDAANLCGKIVDAL
CERMHQQDRFSTLKMLVHKSQAGTIIGLKGSRIKELREITGAYIKVNQECCP
Download sequence
Identical sequences H2ZIC9
51511.ENSCSAVP00000017345 ENSCSAVP00000017345 ENSCSAVP00000017345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]