SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 51511.ENSCSAVP00000019152 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  51511.ENSCSAVP00000019152
Domain Number 1 Region: 930-1056
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.53e-26
Family Calponin-homology domain, CH-domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 51511.ENSCSAVP00000019152
Sequence length 1057
Comment (Ciona savignyi)
Sequence
MVIGKLYLICYHQRETQNLLPAQLQVQPKVLKNLKARQLLALHLLDPKRPRLPPPPLLQA
DDQQHKKMLQKLQRKLAINRNLRLLNLVVLQRHLAVEVRCLPVAELKKLQPSLTNQHFAV
TKSRADDKTLLETKIKDLMALAKTKDSEIRSLKSKLDQMMVLLQKQQDPDPARRESPPTT
FTSLVKLSDDDVTDKNMPLDVATEMGKLQNENMKLREQVDTMIVAIRKKDDMITNHQQRL
HGHDLDTLSNDDGMSSSLEDLTSGGSMDHLQSASRSTSTENLLDCGSGNVLTGSEGCISE
TSSVTVACLTERIHQMEENHISTNEELEATVQELTDLQKSVPELTIDNNRLQREKGFLME
KLDISEKKLEEHSVEIDHLRALVADQLSEDPTHSELKQQYVVLLNERAKLMQLQESITED
VRSAEQARKEQQELAEALRERLRLLERELNHSHTAKSRLEKQLKEAKDEAEEEQSEVIQR
LEDELKEERRRMEELVVGGGSGGEEREIIEALRVEKLELEERYMLLEEDAGQCQLENEKL
DAKVSELEEELEEAKAKTQKDLSELSELIDRLQDDLRMKQASLDEANDTLFVMEDSVEQH
IAVKKHDNHIIHQLQNQISDLKEERFRLEKEIQQLKKEQRNQSEEWKQFQADLQMAVRIA
DGMKAETQSEVTRLRDENQMLDESVTKLRVENEQLRRKRHSSVSSTSAAILEATSLRQGV
GRTSMENNIAALRESYKSRHAANNSPGVQSLIKSFDNQTSTDSPASPSSPTRCHPPLTTS
ASIPAEMGSFSAPFSPSKNQTARSGTSPVTATVSPIQRHHSMSSFSQAGNSPNTTSLTKL
QTPPSGSAASSKPGTPDSRSSCNDLSQLSTLLRRNSNQETRKPLTDILDRLGPSSPSIVR
SQSPIVTSAVTPVQKKHRTTSLATPGGDVLSSLARRYGGSKRNALLKWCQEKTKPYPGID
ITNFSSSWSDGLALCSLLHSYLPAHIPYKSLEQTYMAANDDKTRLQLQAKNFRLAFAAAE
SVGIEPTLTIEEMTLKDRPDWQRVMSYVTQVYKYFET
Download sequence
Identical sequences H2ZNI6
ENSCSAVP00000019152 51511.ENSCSAVP00000019152 ENSCSAVP00000019152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]