SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 51511.ENSCSAVP00000019878 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  51511.ENSCSAVP00000019878
Domain Number 1 Region: 18-106
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000000258
Family Extracellular domain of cell surface receptors 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 51511.ENSCSAVP00000019878
Sequence length 138
Comment (Ciona savignyi)
Sequence
MNVLTSVFFVLVIGVLKGEALDCYQCSLVSSNACNTEALSPLNLQNCAGGEQYCATTTIY
INNSIFGSSTTTTRTCSAVPQAQSCVNLFGVITCTAATCNSNGCNGNTVPNTYSGALKNK
SWLSITLLAILLPLVQYM
Download sequence
Identical sequences H2ZQL2
ENSCSAVP00000019878 ENSCSAVP00000019878 51511.ENSCSAVP00000019878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]