SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 515619.EUBREC_1935 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  515619.EUBREC_1935
Domain Number 1 Region: 313-509
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.27e-42
Family Ribonuclease PH domain 1-like 0.00000929
Further Details:      
 
Domain Number 2 Region: 24-164
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.54e-42
Family Ribonuclease PH domain 1-like 0.0000339
Further Details:      
 
Domain Number 3 Region: 159-251
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.76e-24
Family Ribonuclease PH domain 2-like 0.0053
Further Details:      
 
Domain Number 4 Region: 470-571
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.74e-23
Family Ribonuclease PH domain 2-like 0.00016
Further Details:      
 
Domain Number 5 Region: 578-663
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.07e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 6 Region: 641-717
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.76e-17
Family Cold shock DNA-binding domain-like 0.001
Further Details:      
 
Domain Number 7 Region: 260-339
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.000000000000207
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 515619.EUBREC_1935
Sequence length 718
Comment (Eubacterium rectale ATCC 33656)
Sequence
MYCLVVSEEEYTSAKEFLRRINMYKSYSMELAGRTLTVDIGRVAAQANGAVFIKYGDTTV
LSTATASDKPRDGVDFFPLSVEFEEKMYSVGKIPGGFNKREGKASENAILTDRVIDRPMR
PLFPKDYRNDVTLNNLVMSVDPECRPEIVAMIGTALAVHISDIPFDGPCAMTQMGLVDGE
FIVNPSQKQWDEGDLQLTVASTKEKVIMIEAGANEIPEDQMIEAIYKCHDINQTVIAFMD
QIRDEIGKPKHEYESCAIPEQMFEDIKKIVTPEQMEEAVFTDEKQKREENIRAITEQLEE
AFADNEEYLAVLGEAIYQYQKKTVRKMILKDHKRPDGRAINQIRPLAAEVDLIPRVHGSA
MFTRGQTQICDVVTLAPLSEIQKIDGLDANITTKRYMHHYNFPAYSVGETKVSRGPGRRE
IGHGALAEKALVPVLPSIEEFPYTIRAVSETFESNGSTSMASTCASCMSLMAAGVPIKAM
VAGISCGLVTGDTDDDFLVLTDIQGLEDFFGDMDFKVTGTHKGITAIQMDIKIHGLTRPI
VEEAIARTREARLYIMDEVMSKAIAEPRKEVNEWAPKIEQITIDPSKIGDVVGQKGKTIN
EIIDRTGVKIDITDDGAVSVCGTDKEMIAKAIDMIKIITTDFEQGQILEGTVVSIKEFGA
FIEFAPGKEGMVHISKIAKERINRVEDVLTLGDKVKVVCLGKDKMGRISFSMKDVKED
Download sequence
Identical sequences C4ZBE6
gi|238924296|ref|YP_002937812.1| 515619.EUBREC_1935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]