SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 515619.EUBREC_2226 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  515619.EUBREC_2226
Domain Number 1 Region: 315-465
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.1e-29
Family HD domain 0.016
Further Details:      
 
Domain Number 2 Region: 204-299
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.84e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 515619.EUBREC_2226
Sequence length 515
Comment (Eubacterium rectale ATCC 33656)
Sequence
MLPYIITAVVSIIITALIVWFAAASYEKKSANSKIGNAEEKARGIIDEAVKTAEEKKRES
MLEIKEESIKAKNDLDKEIKERRNEISRNERRIVQKEENVDKKLEAIEKREAGFAVKEEE
LKKQKIEISKLNEQRLQELERISGLTSEQAKEYLLKTIEEDVKLDTAKMIKEMENKAKEE
ANRKAKDYVVTAIQKCAADHVSETTISVVSLPNDEMKGRIIGREGRNIRTLETMTGVDLI
IDDTPEAVILSSFDPIRREVARIALEKLIVDGRIHPARIEEMVEKAQKEVDNMIREEGEA
ATLEVGIHGIHPELVRLLGKMKFRTSYGQNALKHSIEVAQLTGLLAAEIGEDVRMAKRAG
LLHDIGKAVDHEMEGSHIQLGAELCKKYKESPLVINAVESHHGDVEPESLIACLVQAADT
ISAARPGARRETLETYSNRLQQLEDITNGYKGVEKSFAIQAGREIRIMVVPEQVSDADMV
IMARDISKQIESELEYPGQIKVNVIRESRIVDYAK
Download sequence
Identical sequences A0A173SA53 A0A1Q6PKG6 C4ZD02
515619.EUBREC_2226 WP_012743060.1.21182 WP_012743060.1.32465 gi|238924583|ref|YP_002938099.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]