SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 515621.CLJ_B2637 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  515621.CLJ_B2637
Domain Number 1 Region: 291-486
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.62e-47
Family Ribonuclease PH domain 1-like 0.0000119
Further Details:      
 
Domain Number 2 Region: 4-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.44e-40
Family Ribonuclease PH domain 1-like 0.0000333
Further Details:      
 
Domain Number 3 Region: 136-228
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.44e-25
Family Ribonuclease PH domain 2-like 0.0033
Further Details:      
 
Domain Number 4 Region: 447-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.38e-25
Family Ribonuclease PH domain 2-like 0.00016
Further Details:      
 
Domain Number 5 Region: 609-693
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.48e-20
Family Cold shock DNA-binding domain-like 0.00047
Further Details:      
 
Domain Number 6 Region: 237-317
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 2.14e-19
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0021
Further Details:      
 
Domain Number 7 Region: 551-629
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000026
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 515621.CLJ_B2637
Sequence length 702
Comment (Clostridium botulinum Ba4 657)
Sequence
MIHTLETTVAGRKMKVDFGKTGMLSNAAIFMSYGDTVVMINANASKEPREGIDFFPLSVE
YEERLYSVGKIPGGFIKREGKPSDKSILHARSIDRPLRPLFPKGYRNDVQIVNTVLSVEQ
DNLPEILAINGSSLALCLSSIPFTTPVAAVSVGLVDGEFIINPTVAQRENTILDLTVCAT
KERVMMVEAGGQEIDEETMYSAIMFGFEECKNIVAFQEEAVAKFGKTKNEPVLYKADEEV
EKEVKSFAFDMIKEAMYIMDKDERNAQLDKVKEKISEEFSEKYEDKGADISEVIYKTQKE
IVRNMLLNEDRRPDGRAFNEVRPISCEVGILPRTHGTGLFTRGLTQVMTVATLGALGDVQ
ILDGIAEEESKRYMHHYNFPSYSVGEVRPLRGPGRREIGHGALAERALEPLIPSEEEFPY
TIRLVSEVLSSNGSTSQASVCGSTLALLDAGVPIKRPAAGIAMGLITSEDLEKEKVITDI
QGIEDFFGDMDFKVAGTEKGITSIQFDTKIAGLSNSCVKDALEGAKKARLHILGKIKECI
PEPRKELSKYAPRTEIICIDPEKIRDVIGAGGKVINKIIADTNVKIEIKEDGKIFVTSNN
EPEGVKKAISIIEGLTKEVVQGEIYLGKVTKTTNFGAFVEILPGKEGLVHISKLDFARVE
KVEDVVSVGDEILVKVTDIDNQGRINLSRKDAIAKKEEEKDK
Download sequence
Identical sequences A0A0E1KZZ8 A0A2I4P8C1 C3L0B0
WP_003362553.1.20373 WP_003362553.1.28306 WP_003362553.1.34328 WP_003362553.1.49727 WP_003362553.1.5276 WP_003362553.1.57916 WP_003362553.1.59927 WP_003362553.1.69463 WP_003362553.1.95863 WP_003362553.1.97020 gi|237795848|ref|YP_002863400.1| 515621.CLJ_B2637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]