SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 515635.Dtur_1146 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  515635.Dtur_1146
Domain Number 1 Region: 295-486
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.86e-50
Family Ribonuclease PH domain 1-like 0.00000788
Further Details:      
 
Domain Number 2 Region: 4-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.09e-49
Family Ribonuclease PH domain 1-like 0.0000177
Further Details:      
 
Domain Number 3 Region: 449-547
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.93e-27
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 4 Region: 145-237
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.51e-22
Family Ribonuclease PH domain 2-like 0.0032
Further Details:      
 
Domain Number 5 Region: 554-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.84e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0028
Further Details:      
 
Domain Number 6 Region: 616-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000703
Family Cold shock DNA-binding domain-like 0.0016
Further Details:      
 
Domain Number 7 Region: 239-320
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000000112
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 515635.Dtur_1146
Sequence length 693
Comment (Dictyoglomus turgidum DSM 6724)
Sequence
MRQTYSFKKDFAGKTLKIDIGKVAWQATGAALVQYGETTVLVTVVASEEKKEDVDFFPLT
VEYVERLYAAGKIPGGFFKREGKPTEPEILFARLIDRPLRPLFSKDFRNEVQVIVTVLSY
DHENSTDIPSIIGASCAIMLAGLPFKGPIGAVRVGWDGKEWYINPSVALSNSLLLDLVVA
GTKDAVLMIEGDGKEVPEEIFLEGIIRAHEQIGEVINFQEEILSMVNPVPFNYEPFVVNE
NLKKDVLEYVTVDQIRDAIFTPSKSERQKALEDLKKRVIEHFKPIYGEITAQIDEIINQE
AKAILTKVILEEKRRVDGRRLNELRPVSCEVGVLSRVHGSALFQRGETQVLSVVTLGAGE
EQIIESVIESEPKRYIHHYNFPPFSVGEAKPLRGPKRREIGHGALAERALLPLIPKEEEF
PYTIRVVSEVLSSNGSTSMASVCGSSLSLMDAGVPIKTHVAGVAMGLIKEGEKFEVLTDI
QGLEDALGGMDFKIAGTKNGITAVQLDIKVDGLSYEIIEKTLKQAKEARYQILDIMEKTI
SQPRPEISPYAPRIMVLEINPNKIGDLIGPSGKNIKKIIEETHTTINIKPEGLVYISAPD
QESAEKAAQMVQEYTRDIKEGDIFLGKVIRVTDYGAFVEILPGKIGLLHISKYKTTGTGK
NQTREEINLGDEILIKVDSIDPSGRISLSRKDL
Download sequence
Identical sequences B8E2S5
YP_002353039.1.71678 515635.Dtur_1146 gi|217967533|ref|YP_002353039.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]