SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 517417.Cpar_0540 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  517417.Cpar_0540
Domain Number 1 Region: 307-504
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-49
Family Ribonuclease PH domain 1-like 0.0000111
Further Details:      
 
Domain Number 2 Region: 12-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.1e-44
Family Ribonuclease PH domain 1-like 0.0000463
Further Details:      
 
Domain Number 3 Region: 145-236
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.01e-27
Family Ribonuclease PH domain 2-like 0.0016
Further Details:      
 
Domain Number 4 Region: 467-563
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.11e-26
Family Ribonuclease PH domain 2-like 0.0000798
Further Details:      
 
Domain Number 5 Region: 571-656
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.41e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 6 Region: 636-716
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000125
Family Cold shock DNA-binding domain-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 517417.Cpar_0540
Sequence length 732
Comment (Chlorobaculum parvum NCIB 8327)
Sequence
MFIKKEIDLGQGKVITIETGKMAKQADGSAVVRLNDTMVLATVVSSKTPPPPSQDFFPLQ
VEYREKYSAAGKFPGGFFKREGRPSEKEILSARLIDRALRPLFPDGYYQETQIIISVISS
DTINDADVLGGIAASAAIMVSDIPFANPMSEVRVGRINGQFIVNPDTEELQRSDLDICIG
GTEDTICMLEGEMKEISEAEMLDAIKFGHEAIKKLCAFQKELAAEVAKPKRAFAPTVAPA
ELVAFIEANCAAELKALAYTPLAKEERSDRTKAIYKETIAKTLEHFSSITAEEIAANPEK
ALCQSEHMIDECIHDVEKKVMRHMILDDSKRLDGRTLEQVRPISIELGLIPRAHGSALFT
RGETQALVTLTLGTKKDAQSVDTLTDDKDKRFMLHYNFPPFSVGETGRVGGTGRREIGHG
NLAERAIKMVMPAEQEFPYTVRLVSDILESNGSSSMASVCGGTLAAMDGGIPLKKPVSGI
AMGLIKEGDRYAVLSDILGNEDHLGDMDFKVSGTRDGITACQMDIKIDGLDYHILETALE
QARKGRLHILDVMTEAIPESREDIGKYAPRLTSIQIPVDAIGMVIGKGGETIRSITEETG
AEINIDDDGTVTIACSSPEGTKAAVETIKTLVSKPEVGTIYMGKVRDIRDELGAFVEFLP
KTDGLVHISEIARERIAKVSDVLKPGERVKVKLIDIRKDPRTGKTKFALSIKALLDTDQP
AETNGEAKPARD
Download sequence
Identical sequences B3QM09
WP_012501795.1.59511 517417.Cpar_0540 gi|193212209|ref|YP_001998162.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]