SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 517417.Cpar_0700 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  517417.Cpar_0700
Domain Number 1 Region: 328-474
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.13e-20
Family HD domain 0.015
Further Details:      
 
Domain Number 2 Region: 213-304
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 517417.Cpar_0700
Sequence length 524
Comment (Chlorobaculum parvum NCIB 8327)
Sequence
MGIVINLFLIIAASVIFFAVGFYIGRFFLERIGTTKVLEAEERAVQVVQEAQKEANEYKD
LKVNEVNQEWKKRKREFDSEVTIKNNKFAQMQKQIRQKESSLNNQQRDVRETEKKLQEQK
AELKHLTETVQGRSEELEKIIFEQNQRLESISNLTAEEARQMLIDNMVSKAREEATETIH
QIHEEATQKADRAAEKILLTAIQRISFEQATENALSVVHIQSDELKGRIIGREGRNIKAF
ENATGVDIIVDDTPEVVILSCFDPLRREMAKLTLQKLLVDGIIHPVAIEKAYQDAKKEID
DVIMSSGEEVLSSLQIPNMPAELVALIGKMKFHTVYGQNLLLHSREVAMLAGLMAAELKL
DAKQAKRAGLLHDIGLVLPETELPHALAGMEFLRKFNESPVVLNAIGAHHGEVGKESPIA
DLVDAANVISLSRPGARGAVTAEGNVKRLESLEEIAKGFPGVIKTYALQAGREIRVIVEG
DNVSDSQADVLAHDIANKIESEAQYPGQIKVTILREKRSVAFAK
Download sequence
Identical sequences B3QMG7
WP_012501953.1.59511 517417.Cpar_0700 gi|193212367|ref|YP_001998320.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]