SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 517418.Ctha_1519 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  517418.Ctha_1519
Domain Number 1 Region: 320-471
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.71e-20
Family HD domain 0.017
Further Details:      
 
Domain Number 2 Region: 212-300
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000126
Family Eukaryotic type KH-domain (KH-domain type I) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 517418.Ctha_1519
Sequence length 524
Comment (Chloroherpeton thalassium ATCC 35110)
Sequence
MEIAINFGLIIAASLFFLVVGFFIGRIFLERIGTTKILEAEERAIQIVQEAQRESQAEKE
LKVSEVNEEWKRKKREFEQEVSIKNNKFSQTQKQVRVKEDALNRRSEQLQKRERALDDQT
KELNQKLQFVQQRTDELNQLIAEQNQRLVSISGLNAEEAKAMLMDNMIQQAKEEAAETIR
AIHEEAEKTANKTAEKTTLLAIQRVSLDQATENAISVVHLQNDEMKGRIIGREGRNIKAF
ENATGVDIIVDDTPEVVILSCFDPVRRELAKLTLQKLLVDGIIHPAAIEKAFEEAEKELE
EIVLSTGEDTLASLEIPNLHPDLVKLIGKMKYRSSYGQNLLQHSKEVSMLAGLMAAELKL
DSKLAKRAGLLHDIGQMLDSPDSSHAISGMEFLSKYREHPIVLNSVGAHHGEVPKDNPIA
ELVDAANVISSSRPGARGAITPEGYIRRLESLEEIAKSFPGVSKTYALQAGREIRVIVDG
NKIEDAQADMLSHDIAEKIQNTVEYPGQIKISVVREKRSVAYAK
Download sequence
Identical sequences B3QS33
517418.Ctha_1519 WP_012500062.1.43748 gi|193215226|ref|YP_001996425.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]