SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 518766.Rmar_1314 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  518766.Rmar_1314
Domain Number 1 Region: 308-505
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.91e-52
Family Ribonuclease PH domain 1-like 0.0000317
Further Details:      
 
Domain Number 2 Region: 14-146
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.1e-47
Family Ribonuclease PH domain 1-like 0.0000409
Further Details:      
 
Domain Number 3 Region: 467-565
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.88e-29
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 147-231
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.89e-28
Family Ribonuclease PH domain 2-like 0.00073
Further Details:      
 
Domain Number 5 Region: 627-714
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.26e-21
Family Cold shock DNA-binding domain-like 0.0015
Further Details:      
 
Domain Number 6 Region: 558-649
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.71e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 518766.Rmar_1314
Sequence length 772
Comment (Rhodothermus marinus DSM 4252)
Sequence
MMTQTTIHEIEFAPGKSLRLETGRLAKQANGAVVVRQGDTMVLCTAVLADEPREGQSFFP
LTVEYREKFAAGGRIPGGFIKREGRPTDKEILSSRLIDRAIRPLFPDGFFHEVQIICYVI
SADDRYDADVLAGTGASAALLLAGAPFDGPIAEVRVGRVDGQFVVNPTLKELEQSDINLV
VAGKEDAIVMVEGEMKEVSEEDMLEALEVAHEAIRKLCRGQLEFVAAHGRPEPFPYQTTT
LPEELVARVRELAVPKLEAHLRAPYDKQTFYEGLEQIGEETVAALLGTTDAEGNQVLAEA
TPEGWTADQIRKAVSQVTREVMRQMILREGRRIDGRSLDEIRPIWMEVGYLPRVHGSAIF
TRGETQVLASVTLGTSKDVQMIDQIFVQGDKRFFLHYEFPPFCTGEIRFLRGPGRREIGH
GYLAERALAAMLPDESSFPYTIRVNADVLESNGSSSMASVCAGSLALMDAGVPVKKHVAG
VAMGLIKEGDQVAILTDILGTEDHLGDMDFKVAGTRDGITACQMDIKIGGLTREIMQRAL
EQARRARMYILDLMEQTIEAPRPELSPYAPRLTQITIDPEFIGAVIGPGGRVVQGIQRET
NTTIEIEERDGVGVVTVAATNQENAQRAIEMIKQIVAVPEVGAEYEGIVRSIQSFGAIVE
IMPGKEGLLHISELDHGYVRDIHDYLKVGDKVRVKLIEIREDGKLRLSRKAFLPPPEPEA
KNGEPAREQASAERSGPPRDHASGRSHGPGHGRGGRSGRGRGPDRGRGGRRR
Download sequence
Identical sequences D0MI96 G2SG83
gi|268316873|ref|YP_003290592.1| gi|345303219|ref|YP_004825121.1| 518766.Rmar_1314 WP_012843816.1.101848 WP_012843816.1.83145 WP_012843816.1.92079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]