SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 518766.Rmar_2003 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  518766.Rmar_2003
Domain Number 1 Region: 132-223
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.000000000000157
Family TonB 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 518766.Rmar_2003
Sequence length 225
Comment (Rhodothermus marinus DSM 4252)
Sequence
MRPLHRQRERAAYPLRMMASLAFTLGLLVLVVRLWPAPDRTASQAVVYRSLAPEVIALEE
VMPTRQARPAPPPPIPPLPVVVPDEVPLEEVEINPDENRLLLDEPGTDPFAAEGALEGTL
AAAPAFEVGPKPVRFVEPEYTREARRARIRAEIVVEVQVSPTGQVLSATVVERYLLTPHR
QRVDTLGYGLEEAALAAARRWRFRPARVNDEPVPSFTRITFSFGQ
Download sequence
Identical sequences D0MKH2
gi|268317553|ref|YP_003291272.1| 518766.Rmar_2003 WP_012844495.1.83145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]