SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 519442.Huta_2864 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  519442.Huta_2864
Domain Number - Region: 79-116
Classification Level Classification E-value
Superfamily PKD domain 0.0863
Family PKD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 519442.Huta_2864
Sequence length 190
Comment (Halorhabdus utahensis DSM 12940)
Sequence
MTGTTRGQAYALEGVIGVLIIGIALILGMQIVDVAPADNDGDHLREIETQAADVMSLARE
DNLLRSTATCVDTDGEPAMLDPGDPPDTAFETLLEETLENRGTYTITLEYINSSGTIQTE
SLSSRSVPQRASGTVIDQVMLYDSDPVRTGGTCTPTGKTLENASSDEFYLDDHDTDSEIY
GMVKLKVIVW
Download sequence
Identical sequences C7NRS0
519442.Huta_2864 WP_015790587.1.40337 gi|257053925|ref|YP_003131758.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]