SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 521045.Kole_1646 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  521045.Kole_1646
Domain Number 1 Region: 300-496
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.38e-51
Family Ribonuclease PH domain 1-like 0.0000181
Further Details:      
 
Domain Number 2 Region: 7-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.06e-42
Family Ribonuclease PH domain 1-like 0.0000259
Further Details:      
 
Domain Number 3 Region: 459-558
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.7e-30
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 138-232
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.09e-29
Family Ribonuclease PH domain 2-like 0.00089
Further Details:      
 
Domain Number 5 Region: 566-650
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000474
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 
Domain Number 6 Region: 627-700
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000018
Family Cold shock DNA-binding domain-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 521045.Kole_1646
Sequence length 737
Comment (Kosmotoga olearia TBF 19 5 1)
Sequence
MNDYRVWEREFFGRKIIVEHGKMAKQSHGACFVRFADSAILATVNASEEPLPQAGFVPLT
VEFQEKFYAAGKIPGGFVKREGKPSENAILSARLIDRPIRPLFPKGMSNEVQVIVTVLSA
DPDNPPDTIGIFASSLALNISPIPFDGMVAGVRVGYVDGEYIFFPTSEELEKSELDIVVA
GTKEAVTMVEGEAKEVSEEVMLKALMKAHEAIKQLVEFQEEIVSEFEVQKWELEVPEPPE
GFIEAFESLLDDQEIIERMLTPGKKNKGRALKEYRNAIIEEMKEKFTDKWSEDEFVENEH
FLKEHYEEKVKHLMRRSIVERNLRMDGRKTTEIRPITCELDILPRTHGSALFTRGETQSL
ATVTLGAPIDEQIIDTLLEEGSKTFMLHYNFPPFSTGEVKRMRGPGRREIGHGHLAERAL
KNMIPPEEEFPYTIRVVSEILESNGSSSMATVCSGSLALMAAGVPIKRHVAGVAMGLIQE
PDETVILTDILGNEDHYGDMDFKVAGTRDGITAFQMDVKVAGVSEEIMLKALYQAKEARM
KILDLMYETISEPRKEISPYAPVIKVMAVPYEKIGEIIGPGGKVVKKLSTDYDARIFIDD
VKCQVKIIGNDPEKVEKLMGVINAVISDVKEGQVFDGVISRIEPYGIFVEIAPGKTGLLH
SSKFGGDMKEFIKTNNVGAHLKVEVTAIDNLGRIQLKRYGVELTDEQKKSRGRSSGRPSH
YGNRRPNGHKKEGGRNQ
Download sequence
Identical sequences B5M6N5
521045.Kole_1646 gi|239618017|ref|YP_002941339.1| WP_015868980.1.19116 WP_015868980.1.82044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]