SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 521045.Kole_1762 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  521045.Kole_1762
Domain Number 1 Region: 12-244
Classification Level Classification E-value
Superfamily CorA soluble domain-like 3.14e-46
Family CorA soluble domain-like 0.0021
Further Details:      
 
Domain Number 2 Region: 245-306
Classification Level Classification E-value
Superfamily Magnesium transport protein CorA, transmembrane region 0.0000000000222
Family Magnesium transport protein CorA, transmembrane region 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 521045.Kole_1762
Sequence length 310
Comment (Kosmotoga olearia TBF 19 5 1)
Sequence
MIRYFITEKRELKELSEFREKSWVYVVSPDSSDIEVLSKFGIDEDFVWDALDPEERARFE
QDEDIIYVIAKVPYYDEKDPEVPYKTLPIGVAITPTAFVTICLNDNEIFKDFFQNKIKDF
STKKRNRFLLRIFEVAVIYYLRYLKEIRKRSNDIEKELHRSTRNKELVAMLNLEKSLVYF
TTSLRSNELMFEKLKMASILTLYEDDEDLFEDIIIDNRQAIEMAKIYSDILSGMMDAFAS
VISNNLNVVMKVLTIVTLVLQIPMLTASMWGMNIKLPLSGNDYAFAITMGISAVAAVIFG
FTLFKIKWFK
Download sequence
Identical sequences C5CFV3
gi|239618129|ref|YP_002941451.1| WP_015869091.1.19116 WP_015869091.1.82044 521045.Kole_1762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]