SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 521095.Apar_0777 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  521095.Apar_0777
Domain Number 1 Region: 316-467
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.26e-29
Family HD domain 0.02
Further Details:      
 
Domain Number 2 Region: 208-296
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000776
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Weak hits

Sequence:  521095.Apar_0777
Domain Number - Region: 62-148
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0968
Family Formin homology 2 domain (FH2 domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 521095.Apar_0777
Sequence length 517
Comment (Atopobium parvulum DSM 20469)
Sequence
MELAGVGIVCLLVGVGLAYGVLSNISNSKIKTAEQQLKDAQTNADRIASEATRQAETVKK
EAVLEAKEEVLQLKQAAEADEKKRKSELRSMENRILQREESLDHRTDALEKREHQLSSLQ
GQLDRRKNDLDSLVSQQSQELERIAALTKDEAHDELLARVRSESVRDEAMILRESEQRVR
AQADKTAREIISTAIQRVAADQASEITVTSVHIPSDDLKGRIIGREGRNIRTFEQVSGVS
LVIDDTPETVVLSSFDPVRRETARVALENLIADGRIHPARIEELYKKAEALVNERVLEAG
EQAAFDCGIHDLHPEIVKTLGKLRYRTSYGQNVLAHSVQVAVLCGIMAEELGLEPAPAKR
AGLLHDLGKAIDHEVEGPHAVIGADLARRYGERPEIVHAIEAHHADIEPNTVLDMLVMAA
DAISAARPGARRESAENYIKRLEKLEAISNAHEGVERTYAMQAGRELHVMVEPQMISDSE
ATVLAHDIAKQIEDEMEYPGQVRVVVIRESRAVDVAK
Download sequence
Identical sequences C8W6W6
521095.Apar_0777 gi|257784580|ref|YP_003179797.1| WP_012808863.1.33702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]