SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 521097.Coch_1367 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  521097.Coch_1367
Domain Number 1 Region: 5-178
Classification Level Classification E-value
Superfamily Fic-like 1.29e-39
Family Fic-like 0.000000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 521097.Coch_1367
Sequence length 181
Comment (Capnocytophaga ochracea DSM 7271)
Sequence
MNTQEIDAQSLQNAYRLFESGTIEQIEVGTTKGLCEIHCYLFEGLYDFAGEIRRLNISKG
GFKFANAMFLHAILPVIDQMPENTFEEIVAKYVEMNIAHPFMEGNGRAIRIWLDLILKKR
LSKVVNWQLIDKAPYLQAMERSPINDLELRFLLQPALTDKVNDREVIFKGIEQSYYYESN
D
Download sequence
Identical sequences C7M5V4 J0WJH6
WP_009417697.1.29896 WP_009417697.1.37490 521097.Coch_1367 gi|256820195|ref|YP_003141474.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]