SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 521098.Aaci_1442 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  521098.Aaci_1442
Domain Number 1 Region: 289-484
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.58e-52
Family Ribonuclease PH domain 1-like 0.0000102
Further Details:      
 
Domain Number 2 Region: 2-141
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.16e-47
Family Ribonuclease PH domain 1-like 0.0000177
Further Details:      
 
Domain Number 3 Region: 142-232
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.53e-30
Family Ribonuclease PH domain 2-like 0.0015
Further Details:      
 
Domain Number 4 Region: 446-544
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.49e-28
Family Ribonuclease PH domain 2-like 0.0000891
Further Details:      
 
Domain Number 5 Region: 551-636
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.28e-24
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 6 Region: 616-690
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.65e-21
Family Cold shock DNA-binding domain-like 0.00034
Further Details:      
 
Domain Number 7 Region: 235-316
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 2.09e-17
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 521098.Aaci_1442
Sequence length 735
Comment (Alicyclobacillus acidocaldarius DSM 446)
Sequence
MVVRHEFEVAGRRFVLETGKLARQATAAVHVQYGETVVLATVTASKEPKELDFFPLTVNY
EERLYAVGKIPGGFIKREGRPSEHAILASRLIDRPIRPLFPEGFRNDVQIVDLVLSVDQD
CAPEIAAMIGTSASLTISDIPFNGPIGGVIVGLVDGQFVINPTVEQSEKSDLHLVVAGTK
DAIVMVEAGANQVPEEIVLEAILYGHQVIQTICDEINAFAQKVGVKKREVELHKVDPELE
AAVRAYATDKVSAAVRNPDKLAREEALANLNAEVLEHFKETFPEKEADIAEVMHTILKER
VREAILREGIRPDGRRLDEIRPISCEVGLLPRTHGSALFTRGQTQALSVCTLGSMGDEQL
LDGLELEKSNRYMHHYNFPPFSVGEAKPLRAPSRRDIGHGALGERALDPVIPSPEEFPYA
IRVVSEILESNGSTSQASICGSTMALMDAGVPIKAPVAGIAMGLVKEGDQVAILSDIQGI
EDHLGDMDFKVAGTERGVTALQMDIKISGIDRSILERALKQAREGRMYILSKMMEAISEP
RADLSKFAPRVITVKIHPDKIRDVIGPGGRVINKIIEETGVKIDIEQDGRVYIHSTDAEQ
ANRAREMVENIVRDVEVGATYTGKVTRVEKFGAFVEILPGKEGLVHISQLDLNRVAKVED
VCQVGDTLTVKVTEIDNQGRINLSRKEVLKAMQPPAPPQPPRPSSGPGRGPQGGHGRRDH
GHSAGPKAAPRRTSP
Download sequence
Identical sequences C8WWJ6
WP_012810782.1.29831 521098.Aaci_1442 gi|258511422|ref|YP_003184856.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]