SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 521460.Athe_1057 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  521460.Athe_1057
Domain Number 1 Region: 291-486
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.27e-51
Family Ribonuclease PH domain 1-like 0.00000976
Further Details:      
 
Domain Number 2 Region: 6-143
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.19e-48
Family Ribonuclease PH domain 1-like 0.0000242
Further Details:      
 
Domain Number 3 Region: 448-548
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.41e-28
Family Ribonuclease PH domain 2-like 0.0000878
Further Details:      
 
Domain Number 4 Region: 225-324
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.09e-26
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0038
Further Details:      
 
Domain Number 5 Region: 137-230
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.13e-26
Family Ribonuclease PH domain 2-like 0.0026
Further Details:      
 
Domain Number 6 Region: 555-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.31e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0055
Further Details:      
 
Domain Number 7 Region: 618-692
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.58e-19
Family Cold shock DNA-binding domain-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 521460.Athe_1057
Sequence length 701
Comment (Anaerocellum thermophilum DSM 6725)
Sequence
MESKIYKMELAGRELSFEIGKYALLANGAVLARYGDTAVLVTACASEKPREGINFFPLTV
DYEERLYSVGKIPGGFIKREGKPSEKAILSARLIDRPIRPLFPKDFYHDVSVIATVLSVD
PDNPPDVLAMLGSSVALSISDIPFEGPTGSVLVGYVDDKIVINPTAKEREVSKLHLVVSG
TKDRVMMIEAGAKEVSEDIMLEAIMRAQEEIKKIVEFIEGIVREVGKPKMEYQKRIVPED
IKQKVREIAYDKVYQYVQIPDKIERDKKLDELKEEVFKAFEGETEETLLLVDDALYSLEK
EIVRKMIAEEGKRPDGRKFDEIRPLYAEIGILPRTHGSALFKRGYTQVLTVATLGTKGEM
QFLDGLEEEEAKRYMHHYNFPPFSTGESKPVRGPGRREIGHGALAERALEPVIPSEDEFP
YTIRLVSEVLTSNGSTSQASVCGSTLALMDAGVPIKAPVAGISIGLITKDDGSFILLTDI
QGIEDFFGDMDFKVAGTREGITAIQLDIKIHGLTKEIIEKALYQAREARLKILDFMQTVI
DKPRSELSPYAPKIFKTTVDPEKIRDIIGPGGKMINKIIAETNVKIDIEPDGRIFVAAPD
DISGNRAISMIEGIGREIEVGQFFLGKVTRTASYGAFVEIYPGKEGLVHISQLDERRLKS
VDEVVKVGDLVLVKVIGIDKLGRLSLSRKEALNVTYSRKAK
Download sequence
Identical sequences B9MR54
521460.Athe_1057 WP_015907570.1.1144 WP_015907570.1.22435 WP_015907570.1.28668 WP_015907570.1.33084 WP_015907570.1.45436 WP_015907570.1.58293 WP_015907570.1.61668 WP_015907570.1.71443 WP_015907570.1.77617 WP_015907570.1.9959 gi|222529049|ref|YP_002572931.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]