SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 522373.Smlt1156 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  522373.Smlt1156
Domain Number - Region: 50-88
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.000196
Family TolA 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 522373.Smlt1156
Sequence length 134
Comment (Stenotrophomonas maltophilia K279a)
Sequence
MMRTSLPALLLLGLSPWALANASCTPEDLVGATPVRLPASTVISAPKEFSIVLTTGQDGS
FGAIRARLSSGNRELDRAAAESIRQASLAVSCLQEPGEEIIVVFSALPAQPGQPGNGTVQ
IVRIAPAAPKPTKP
Download sequence
Identical sequences A0A1V3D4Y4 B2FS07 J7UNQ9
522373.Smlt1156 gi|190573181|ref|YP_001971026.1| WP_005408434.1.15125 WP_005408434.1.38566 WP_005408434.1.4992 WP_005408434.1.51731 WP_005408434.1.53081 WP_005408434.1.5674 WP_005408434.1.65590 WP_005408434.1.69794 WP_005408434.1.72571 WP_005408434.1.7336 WP_005408434.1.80113 WP_005408434.1.82179 WP_005408434.1.85246 WP_005408434.1.87555 WP_005408434.1.94929 WP_005408434.1.98612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]