SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 523794.Lebu_0691 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  523794.Lebu_0691
Domain Number 1 Region: 321-477
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.96e-29
Family HD domain 0.018
Further Details:      
 
Domain Number 2 Region: 212-300
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000228
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 523794.Lebu_0691
Sequence length 524
Comment (Leptotrichia buccalis DSM 1135)
Sequence
MSISIAILLIVIFSFLTFFIAYFFGSSIFKKKYGDLNELELKIVDAKRRLETSKKEVERE
IESFRKEETLKVKEELLNEKKIADDEIKKMKSELATKEERIAKKEETLETKMERLEEREA
KNEKYREKLFRREKELEEMIANEEKELERISELTQEDARKIILTKLENELDHDKAVLIRD
YEHNLDREKDRISKRIISTAIGKAASDYVVDSTISVIQLPSEEMKGRIIGREGRNIRAIE
AATGVDLIIDDTPEAVVLSSFDGVRREVAKIALEKLISDGRIHPTKIEEVVAKAQHEVDE
SILDAAEQAILEVGIPTLPREVLKVFGRLKFRTSFGQNILQHSIEVAHIASALAAEIGAN
VDIAKRAALLHDIGKAFSHEQEGSHALNGGEFLRKFSKESEIVINAVEAHHNEVEQLSIE
AVLVQAADSISASRPGARRETLSNYLKRLEQLEEIANSHEGIESSYAIQAGRELRLIVHP
DNIDDDRATILAREVAKEIEEKMQYPGQIKVTVIRETRAVEYAK
Download sequence
Identical sequences C7N8W8
gi|257125476|ref|YP_003163590.1| WP_015768947.1.20655 523794.Lebu_0691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]