SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 523794.Lebu_1045 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  523794.Lebu_1045
Domain Number 1 Region: 4-150
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.11e-29
Family GHMP Kinase, N-terminal domain 0.00071
Further Details:      
 
Domain Number 2 Region: 163-282
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.09e-25
Family Homoserine kinase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 523794.Lebu_1045
Sequence length 297
Comment (Leptotrichia buccalis DSM 1135)
Sequence
MGLKFKVKVPGTSANIGVGYDCLGVALDYFLELEVEESDKIEFLENGKPFSIPIEENLIF
EAIKYTEKYLVKNIPSYKVNIVKNNIPISRGLGSSSSAIVAGILIANKFAGDVLDINEVA
KLAVEMEGHPDNVVPAIFGGMVLTAHDKENIVHSSLINSDDLCFYVMIPDFKLSTEKARS
VLPKMYLVSDAINNISKLGLLVNAFNKGEYNNLRFLLGDKIHQPYRFALINDSEKIFEIS
KKYGALGEYISGAGPTLISLNYDNDEFLENMKKELSELSDNWTIEKKKINLKGAEVY
Download sequence
Identical sequences C7N9W4
523794.Lebu_1045 WP_015769291.1.20655 gi|257125822|ref|YP_003163936.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]