SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 525897.Dbac_2431 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  525897.Dbac_2431
Domain Number 1 Region: 35-125
Classification Level Classification E-value
Superfamily FlaG-like 5.36e-24
Family FlaG-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 525897.Dbac_2431
Sequence length 127
Comment (Desulfomicrobium baculatum DSM 4028)
Sequence
MKITSLAYEPQDLLAPVEHTTQLKSDLEYADRAESGGLQDRQQGMESDQSEEISLQKLQN
LTDAVDSYMSSLGVNLKFHIDERTDTVQVEVRDPDTHKLIRKIPADEMLDLADSIEKMVG
LFLDRAL
Download sequence
Identical sequences C7LRK2
525897.Dbac_2431 gi|256830198|ref|YP_003158926.1| WP_015774599.1.63071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]