SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 525903.Taci_0719 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  525903.Taci_0719
Domain Number 1 Region: 289-486
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.58e-49
Family Ribonuclease PH domain 1-like 0.0000159
Further Details:      
 
Domain Number 2 Region: 6-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.48e-46
Family Ribonuclease PH domain 1-like 0.0000189
Further Details:      
 
Domain Number 3 Region: 452-559
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.5e-27
Family Ribonuclease PH domain 2-like 0.00014
Further Details:      
 
Domain Number 4 Region: 143-234
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.13e-25
Family Ribonuclease PH domain 2-like 0.0016
Further Details:      
 
Domain Number 5 Region: 553-639
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.6e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 
Domain Number 6 Region: 619-693
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.38e-17
Family Cold shock DNA-binding domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 525903.Taci_0719
Sequence length 752
Comment (Thermanaerovibrio acidaminovorans DSM 6589)
Sequence
MHKVVQLELGGRVLSFETGRMAKQANGAVYASYGETAVLVTSVMSEKPREGLDFFPLLVD
YEERFYSAGKIPGGFIKREGRPSETAILSGRMVDRSIRSLFPEHMRNDVHVVATVLSVDQ
HNPPNVLAINAASAALAISDIPWDGPIGAVRIGCIDGQLLVNPTEPQMAESTLDLLVAGH
DGGITMVEAGANEVSEDLLVDAMELAHQEIRRIVAFIRDLQAQVGLKKVEIAPPARIDEI
DAWIEAELKEEIYKAVQIHHKVERKDALSAITKRAVERFEESHPGCAGYVASVVEEWVKK
GLRRLLLDEGRRADGRAMDQLRPITCEVGVLPKVHGSALFTRGETQALAVTTLGMMGEDD
QILDGLKIDEPAKRFLLHYNFPPYSVGEVRPMRGPGRREIGHGALAERALRPMLPSEDQF
PYVVRVVSDILESNGSSSMASVCGGSLSMMDAGVPIKKAVAGVAMGLVTDGSRVCILTDI
QGLEDHYGDMDFKVAGTRDGVTALQMDNKAGGITREILKRALDQARDGRMRILDIMDGAI
RSPRDQISPNAPRIMTITIDPDKIRDVIGPGGKTIRSIIAQTGAKVDVQDDGRVCVAAQT
EEAASQAIKIISDLTREVQAGEIFVGRITRMLGFGYFVEVLPGKEGLLHVSEISSHHIPK
IEDAFSIGDEVLVVVREIDDMNRINLSRRRLIDRYDQLAKDPALAAQVEVERAREIRYGT
LKPEGGSPKGPQGRRDSDRRPSGGDRRDKHHR
Download sequence
Identical sequences D1B9J9
YP_003317234.1.71145 525903.Taci_0719 gi|269792330|ref|YP_003317234.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]