SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 525903.Taci_1523 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  525903.Taci_1523
Domain Number 1 Region: 149-220
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 2.22e-18
Family TonB 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 525903.Taci_1523
Sequence length 228
Comment (Thermanaerovibrio acidaminovorans DSM 6589)
Sequence
MRRALPFLLASLWIHWAVLGIITPRSHQPPGIHVMRITIETAPTAPPSVTPGADPPKAKT
EAPVKTPAKQNRIPSERNPSARRAPKEASLGEAKDRGGTDRSGDTDGPAGGPPAEGAPAG
EGGLPSGGQAEGGGTGETLPGGTAEDATLRVKPRYPRAARQRGEEGTVVIRLTVRDGVPI
DARVESSSGSPRLDRAALEAAAMWRFRPQVNGEVRIPFLFRLVDPDPR
Download sequence
Identical sequences D1B6V3
gi|269793122|ref|YP_003318026.1| YP_003318026.1.71145 525903.Taci_1523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]