SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 525919.Apre_0491 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  525919.Apre_0491
Domain Number 1 Region: 4-154
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.82e-33
Family GHMP Kinase, N-terminal domain 0.00011
Further Details:      
 
Domain Number 2 Region: 162-268
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.0000000000000403
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 525919.Apre_0491
Sequence length 278
Comment (Anaerococcus prevotii DSM 20548)
Sequence
MERKCYAKVNLTLDSLSKRDDGYHEIDSIMVRINLFDKLIIKKNKENKFNYETNTPNICA
LEDNLIYKAWCLLKDRVDENGVDVTLIKNIPLAAGLAGGSTDAAEMIKGLDKLWDLGLTI
DERMCLGKKLGADIPFFFLESNARAQGIGEILTPFTNKLKMKLLLINDGTEISSAFIYKR
LADYGVIDTSEIIDKLRKGEKSAISGFRNVMEDVIFENFPHIREICSRLEDIGAEKALVS
GSGASVFGVFTDDYSLNLAYEKLSDKYKFVEKVELVDD
Download sequence
Identical sequences C7RGC7
WP_015777449.1.19141 gi|257066003|ref|YP_003152259.1| 525919.Apre_0491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]