SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 526218.Sterm_1645 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  526218.Sterm_1645
Domain Number 1 Region: 17-60,101-191
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000458
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 526218.Sterm_1645
Sequence length 204
Comment (Sebaldella termitidis ATCC 33386)
Sequence
MSLADRYFEGLEELMTDEQIEKFEIIPPATEDEISRLEKFYPDCPESLLDLWRMKRGTYH
EEIDDVYILLPVLSSDVEGGEYPYYLKSCVQILEEAEKNYNKQSIEEIYGEDWIKENSED
FDKRIKMNISHNKWLNFADCINNGGTSRLFIDFDPKGKGVKGQIIRYLHDPDSYIVIANS
FDEYLENIIGEEYPFSHIYEEWDD
Download sequence
Identical sequences D1AIB9
526218.Sterm_1645 WP_012861099.1.35130 gi|269120257|ref|YP_003308434.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]