SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 526218.Sterm_1979 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  526218.Sterm_1979
Domain Number 1 Region: 298-493
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.48e-47
Family Ribonuclease PH domain 1-like 0.0000228
Further Details:      
 
Domain Number 2 Region: 6-144
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.05e-45
Family Ribonuclease PH domain 1-like 0.0000523
Further Details:      
 
Domain Number 3 Region: 455-554
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.62e-29
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 4 Region: 138-231
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.63e-29
Family Ribonuclease PH domain 2-like 0.0014
Further Details:      
 
Domain Number 5 Region: 614-698
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.71e-19
Family Cold shock DNA-binding domain-like 0.0007
Further Details:      
 
Domain Number 6 Region: 238-326
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000000000000201
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0025
Further Details:      
 
Domain Number 7 Region: 557-634
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000108
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 526218.Sterm_1979
Sequence length 710
Comment (Sebaldella termitidis ATCC 33386)
Sequence
MFNEKSYELKIGEKTVKISSGKIARQASGAVIVECGKTVLLVTATRSKEVREGTDFFPLT
VDYIEKFYASGKFPGGFIKRESRPSTDEVLIARLIDRPIRPLFPEGFFYGVHIVITVISF
DEVNLPENLATLGVSAALSISDIPFAGPVGGVNVGYIDGKFVLNPTPEELEISDIELSVA
GTADAVTMVEAGANEIPEDIMLEAIMFGHGKIKEMCEEQEKFISQFEVNKMEFEVAEVNP
EVKSFIDEKATEELGAAIEKHGKHERDDAIDALFDRLLEEFSASYENNEIPADIAKEFKN
YYHDLMKKMVRESILYKKNRPDGRKTEEIRPIDVEIDTLPIPHGSALFTRGETQALVTVT
LGSRVNEQIVDGMEEESRKKFYLHYNFPPYSVGEAGFMRAPGRRELGHGSLAERALKYMI
PEQEDFPYTIRVVSEITESNGSSSQASICGGSLALMAAGVPMKSSVAGIAMGLIKENEEF
VVLTDIQGLEDHLGDMDFKVAGTKNGITALQMDIKITGITREIMEIALKQAHNGRMFILD
KMNAVIPEPRKDVSENAPKIHFMKIDPSKIAILIGPGGKTIKSIIDQTGATIDIEDDGSV
AIFVKEKSSLDKTIELVKSYTQSVELNAVYTGRVVKIAKFGAFVEVLPGKEGLLHISEIK
KERVNKVEDVLKEGQIIKVKVIGMEDENKFNLSMKALENEKVGGNDESAK
Download sequence
Identical sequences D1AJE6
526218.Sterm_1979 WP_012861428.1.35130 gi|269120588|ref|YP_003308765.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]