SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 526222.Desal_0996 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  526222.Desal_0996
Domain Number 1 Region: 299-493
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-48
Family Ribonuclease PH domain 1-like 0.0000154
Further Details:      
 
Domain Number 2 Region: 13-147
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.09e-40
Family Ribonuclease PH domain 1-like 0.0000447
Further Details:      
 
Domain Number 3 Region: 456-554
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.91e-28
Family Ribonuclease PH domain 2-like 0.0000716
Further Details:      
 
Domain Number 4 Region: 148-237
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 8.55e-23
Family Ribonuclease PH domain 2-like 0.0033
Further Details:      
 
Domain Number 5 Region: 615-700
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.4e-17
Family Cold shock DNA-binding domain-like 0.0006
Further Details:      
 
Domain Number 6 Region: 561-626
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000043
Family Eukaryotic type KH-domain (KH-domain type I) 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 526222.Desal_0996
Sequence length 750
Comment (Desulfovibrio salexigens DSM 2638)
Sequence
MLVPFTPTSVTGHVGNLDITLETGRMANQTNGTVLIKSGGTVVLVTAVGMPADGPRDFFP
LTCNYLERTYAAGRIPGGYFRREVGRPSDRETLVSRLMDRPIRPMFPKAYRDEVQVIATV
LSADTDTNPDVLAMTGASAALHISDLPFNGPVAAARVGLVDNEFVLYPTYKGVAEQSDLN
LVFAATRDAVIMVEGSSQFLSENTIAEALEWGHEQMAPMFDLQDALREKVGRPKLEVSEP
EKDEEVITLVTENFSADLDKALTIPGKLDRKAAKSEVKASAKAMIEEKFPEEPERAKAVG
DAMADLEKKIVRKRIVEQGVRIDGRDLTTVRNLSMEVSNLPMTHGSALFRRGETSALAVC
TLGSTRDEQRFETLIGEDTKRFMLHYNFPPYCVGEAKFLRAPSRREIGHGTLAERALRPV
LPKAEDFPFTMRVVSEVMDSNGSSSMATVCGTTLSLMDAGVPISAPVAGIAMGLCQEGDE
YFVLTDILGDEDALGDMDFKVAGTEEGITAIQMDIKISGIPADVLRRALAQAKDARQIIL
DDMKETMPEPRAELSVNAPQMEVLQINPEKIRDLIGPGGKNIKAITAETSADIDIEDSGK
VSIFAPTLESLKKTVEMVQYYDQTAELGKNYVGTVKKILEIGAIVEILPGLEGLLHISQI
DVERIAEVTDVVQLGQEITVKVVEVQPNGRIRLSRKAWLMEQAGQEVDLEKFKMGGGRPG
GNRGGRDGGRRDDRRDDRRGGGRRDDRRRR
Download sequence
Identical sequences C6C0C7
WP_015850880.1.7152 526222.Desal_0996 gi|242278471|ref|YP_002990600.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]