SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5270.UM03021.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5270.UM03021.1
Domain Number 1 Region: 3-84
Classification Level Classification E-value
Superfamily Translational machinery components 5.75e-20
Family Ribosomal protein L18 and S11 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5270.UM03021.1
Sequence length 85
Comment (Ustilago maydis)
Sequence
MKVKADRDESSPYAAMLAAQDCAVRCKEVGITALHIKLRATGGTGTKTPGPGAQAALRAL
ARAGMRIGRIEDVTPVPTDSTRRKD
Download sequence
Identical sequences UM03021 5270.UM03021.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]