SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5270.UM04312.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5270.UM04312.1
Domain Number 1 Region: 16-242
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.66e-79
Family Calponin-homology domain, CH-domain 0.0000227
Further Details:      
 
Domain Number 2 Region: 259-379
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-26
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 3 Region: 493-615
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000249
Family Calmodulin-like 0.0091
Further Details:      
 
Domain Number 4 Region: 383-488
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000672
Family Spectrin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5270.UM04312.1
Sequence length 637
Comment (Ustilago maydis)
Sequence
MAYKRSSVLVGLPDQDRGWEEVQAKTFTKWLNTKLESRQIAPMRSLATDLSDGVKLVQLM
EIMGDTTLGRFYMNPRMRVQKAENVNLALEFIKSRGVVLTNVGAEDIVDGNLKLILGMIW
TLILRFTIADISEEGVTAKEGLLLWCQRKTAPYQEVEVTNFTTSFKDGLALCALIHRHRP
DLLNFDALPKSDAHACTRTAFQVAEHHLGIPQLLDVEDLCDRTKPDERSVMTYVAQYFHA
FSSMEQAEVVSRRVATFADVMQGAWLMQQDYERRARQLVDTMSELQNGWTAATFAGTYAD
ARTQLTQFNQYKIGVKRELVRERTDLAALLGNIQTKLKTYHLPEWLPQLGLRQTDLETAW
ATLALAEAHRSRSINAEIRNAKENLRIKFAKAANEFERQLREVAGGIATLEGDLEAQLEV
VKHLLAQLDPIKEQLTLIASLEQECTEAKVEENDHTIFTLSDLSFEWELVRASVSKKLAF
IENQIVSRQHTNLTPAQLEEFESTFRYFDKDASNTLTVPELGAALASLGIIYTEDDIEQI
HLQLCETFGAVSYDAFLTFLREITEDTTSPDQLLEAFQGLAGDKPYVTELDLRLALLPQG
SIDYLKAAMPQVRVDGVEDAVYDYEGYLTGLFGVAQP
Download sequence
Identical sequences A0A0D1DXH0
UM04312 XP_011391034.1.11705 5270.UM04312.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]