SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5270.UM05668.1 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5270.UM05668.1
Domain Number 1 Region: 1057-1187,1219-1420
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.69e-67
Family p120GAP domain-like 0.00037
Further Details:      
 
Domain Number 2 Region: 395-551
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.05e-39
Family Calponin-homology domain, CH-domain 0.0000118
Further Details:      
 
Domain Number 3 Region: 1657-1739
Classification Level Classification E-value
Superfamily RGC domain-like 0.000000000235
Family RGC domain 0.0069
Further Details:      
 
Weak hits

Sequence:  5270.UM05668.1
Domain Number - Region: 859-939
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00263
Family Tandem AAA-ATPase domain 0.055
Further Details:      
 
Domain Number - Region: 784-880
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0114
Family Motor proteins 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 5270.UM05668.1
Sequence length 1774
Comment (Ustilago maydis)
Sequence
MMDQQAKPTLPAASPNARGSGSANASASPFAYQSKYLERSASRSSTFSLASSLDTAPRTG
LQPSGSIRRFPAPHRHTASLDPHRAAELRAAALAHSPTASPLGASVSTFGSNTTLSSSGS
NHSIGAPTTSPAPATFSKATFPAASRGVNGRPTSMPPAPRDNLFNSSTVGRARAYSPTKD
PYDRAVSPTKNLSYDSPLSSPKKDDSSWIQSPSTPKQHGSFWSNASNGAYPGSNATGPSQ
LHLGGVKDLKRSSVGALKMIKDFTQKTDELGTLGTLGDQHSHTRMTVGRSRGQRTQSLGA
SSAPLADRLNSLNLEPTIQEGWQKPGRPGRMESEDQEGEIVLPGITTGAEDVAGLHGRIR
LARADGPGTMALGRPSTTSSNLPLTSSSKWMDTQRHLLQAYEYLCHCGEAKEWMELHVGE
HLGDVVEMENEMRNGIFLAKLAKNFEPECVPRIFVHPKLQYRHTDNINYFFSFINKVGLP
HFFQFELTDLYEKKNFPKVVYCIHALSHVLARQGRALKVGNLIGKLEFTDDQLQKTQKGL
DASGVAMPSFGAVGKALAKEMNIEPEPEPETEQERIDRDLMENLDAVVALQAASRAFVAR
VRFADRLHAEIQRRHQEEARMAAAAEAERVRQRQAEEDRIISRWAPTIQAQIRGVLTRRT
HHRKQAALHTSTRTFVGLQAAVRAKLARQTHVEHVKRVHDIGNARAIENFQACVRGALYR
RRFFENIKALDKHETSVVGLQAQIRGRLARAAYENLIYRLADSTEDVIRLQAACRSVLAK
QNLLNTIRGLRSSSDAITAVQAQVRGVLARKNHVRMRSALQKVEVKAAVGGLQSFARAAL
ARRKHQEQKKQLDFVTPDVVGIQAAIRGMLVRLEYDWWRNHITQSEPVAIHLQSLIRGAL
SRRKFFSRLRHYHEHMDKVVKIQSLFRGRQQGEQYRSLTMGKNVPVATIKNFGHLLNDSD
ADFEDEIEVERLRKLVVRAIRESQTLESDVSELDTKIALLVKNKIGIEELIKAKNERGLL
GQRDAAAAVQKRNSVLVAANDPFADHALDRASRRKFELYQELFYALQTRPEYLARLFARV
GKIEMADRDKRQVEKIVLTLFGYAQKAREEFLLLKLFQRCVEEELGFVSTVQEFIRGNAQ
FIKLVAQYNRGARERKYLKDLLGPLVSDIMAQEGLDLETDPCAIYRATINQEEMETGQPS
RRPLEVAFNEALADPMARTIFIRHLQSLRATTEAFLSAILSSTRKMPYGVRYIAREVFRA
LQSKFPDEPQDALIKVVGHLVYYRYLNPAIVAPEGFDVVETLVGPVQRKNLAEVSKMLTQ
IAVGRLFNDENPYLQPLNDYVSHASERFTKWLYGIIDCADAEMQFSADEFLDHTVQEKPV
IYISPNEIYSMHLLLSQQIDHLAPQAEDPLRVVLKELGAPPVSNTQELNSARDSEITFEL
VSRMATLQDPEAETKALFVETKRLVLCLLKVQSGKTLVDVFVAPVTDVEELQWEEIVSLE
IAADRQRQRGSRPPGLAMYGGASGGGRLEDVRRLSFAELKARTLENMLQLEQLGKVSRAN
KYQDMLNAIAIDIRNKHRKRIQRANEKTAMHTTLKTLDDKKAYLQEQIDSYHSYIDASMQ
TMQGGRKGKKRFVLPFSQQYFHLRSLKANGGKVPKFGSYKYAASKLLDKGVVVSVDGLVA
RPDTASTTAPVAAPAEVHFTISSDQPGVFTIQVLNGPSAGASADLRIEDLLESQACAETA
VSWQSHGGQQDERCVLCRDADVGGGGEADAHGCG
Download sequence
Identical sequences 5270.UM05668.1 UM05668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]