SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5306.JGI65203 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5306.JGI65203
Domain Number 1 Region: 544-612
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000278
Family Calponin-homology domain, CH-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5306.JGI65203
Sequence length 613
Comment (Phanerochaete chrysosporium)
Sequence
MATAVLPSQKPSLHTSDPFHMAPSSSMDAPSSRRPAVASSSRHPPSSSQLSTTSQSDSRQ
RTFSRLRTSLENTLRSGSRLRSKPSVDEVGTLSAGKGKERAAPGSEDVVATKERSKSSML
SKVSFRRPGGKEPAAQSAGLPAASGSRVEADKVEKDRDKSKARAQGHTTFEAPSLRQASM
SSPAIHLASEAFPSPYSQPFALPAASSSNVSALVSPPRERPPRRSTDKGTISTKEISGPL
PLAAVARRDSRTNGSATTTGEQKASKHRPPPVSVSLANAGTSRGRMSLDSQLDTPTTSRT
RAGPRSSDSIPPSPTPRAGHAVAGTLAKRAAASTSHLPAGDSPNSSTSTNAPASPTPSRS
QARSPSRTPTHRARQPSASASTSHLPLSSPTPSARRPSGELPRRSVEAARVSPTTSRAGS
PSTALRARAASPPQRNFSPLGNLRGVNASTASLAAGASAEQRELVRTAAGLLVKEMLKPP
SPVREPGGLDAKEYEEVEVRLRSLARLERVWGKSGQGTLSASTLSLGAGGSTGLSAGGEE
RERRLVNKLHPGLISRVDRREDGFMRTSNVTRFLAACSSLGVPPEELFHRDDLIESTPDS
MVRVAKCIIALLR
Download sequence
Identical sequences 5306.JGI65203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]