SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5306.JGI68111 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5306.JGI68111
Domain Number 1 Region: 5-167
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-43
Family p120GAP domain-like 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 5306.JGI68111
Sequence length 180
Comment (Phanerochaete chrysosporium)
Sequence
HVISRGNTVFTKTMEIFMMTKGAAFLEASIGSAIRRLCTLGIAIETDPSRSGKNAKQIEK
NVDLLVYWCQEFWKSIYDARDKCPDDMRKLFSHIRTLIETRYQVAEDRYPDLPWQGVSAF
VFLRFFIPAILHPHYFGFWPGLTDEPVQRSLTLIAKVLQSLANLNTVSYYFVRFFSSVNT
Download sequence
Identical sequences 5306.JGI68111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]