SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 5306.JGI70975 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  5306.JGI70975
Domain Number 1 Region: 2-52
Classification Level Classification E-value
Superfamily HMG-box 0.0000000000615
Family HMG-box 0.0025
Further Details:      
 
Domain Number 2 Region: 66-123
Classification Level Classification E-value
Superfamily HMG-box 0.00000000275
Family HMG-box 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 5306.JGI70975
Sequence length 129
Comment (Phanerochaete chrysosporium)
Sequence
VQQAAKEAGAQWRNMSDAERKPFVDEFEALREDYIKRRDEYLANVDPKIVKELNRRAQKR
DPEARLIKRRSKLAGSPATPFLRFYNETFRPRYIAENPGASLAESARAGGAAWRALSERE
KQVCSNPIS
Download sequence
Identical sequences 5306.JGI70975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]