SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 543728.Vapar_0493 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  543728.Vapar_0493
Domain Number 1 Region: 4-118
Classification Level Classification E-value
Superfamily ApaG-like 1.44e-46
Family ApaG-like 0.000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 543728.Vapar_0493
Sequence length 131
Comment (Variovorax paradoxus S110)
Sequence
MPHSPIRVQVEPRYLADQSSPKDKIYTFAYTVTVTNEGETSAQLIARHWLINDASGHAQE
VKGLGVIGQQPLLAPGESFRYTSGCRLQAPSGTMHGSYFMVTEDGERFDVPIPMFVLEAD
IGGAPVSRVLH
Download sequence
Identical sequences C5CJF6
543728.Vapar_0493 gi|239813512|ref|YP_002942422.1| WP_012745656.1.27117 WP_012745656.1.44240 WP_012745656.1.84832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]